PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g02390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 91aa    MW: 9736.91 Da    PI: 8.8549
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g02390.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.94.2e-322178260
     ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                    ++vrY eC+kNhAa++Gg+avDGC+Efm+s + +g   al+CaACgCHRnFHRrev++e
  Vang09g02390.1 21 RNVRYGECQKNHAANIGGYAVDGCREFMAS-TGDGGGGALTCAACGCHRNFHRREVQTE 78
                    689**************************9.6667899*****************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-21187IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-282275IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-252475IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.9052574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048509Biological Processregulation of meristem development
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MKKRQVVLKR DVANTSSSVT RNVRYGECQK NHAANIGGYA VDGCREFMAS TGDGGGGALT  60
CAACGCHRNF HRREVQTEVV CEYSPPNSAR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-151AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495565.16e-62PREDICTED: mini zinc finger protein 3-like
SwissprotQ2Q4933e-42MIF3_ARATH; Mini zinc finger protein 3
TrEMBLA0A0S3RGA37e-62A0A0S3RGA3_PHAAN; Uncharacterized protein
STRINGGLYMA04G33640.12e-53(Glycine max)
STRINGGLYMA06G20810.12e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.16e-33mini zinc finger